PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_8780V3.1.p
Common NamePHYPADRAFT_76816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2317aa    MW: 254516 Da    PI: 6.2341
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_8780V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.5e-0810681109346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                         +WTteE +++++ ++++ +  +k Ia+ +   +t  +c+++++ 
  Pp3c11_8780V3.1.p 1068 PWTTEEKKIFAEKFALHRKS-FKEIASNLK-YKTTADCIEYYYR 1109
                         8*****************88.********9.9**********85 PP

2Myb_DNA-binding33.21.2e-1013001342347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                          WT eE el+  av+ +G++ +++Ia+++g  + l qck ++ k 
  Pp3c11_8780V3.1.p 1300 QWTDEERELFTSAVATYGKD-FRLIASHVG-SKNLSQCKAFFSKT 1342
                         6*****************99.*********.99******999876 PP

3Myb_DNA-binding30.11.1e-0916351676346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                         +WT+eE e+++   +++G++ W++  + ++  ++l q+k ++q+
  Pp3c11_8780V3.1.p 1635 SWTQEEKEKFAVILQEHGKD-WALLHESLP-SKSLTQIKTYFQN 1676
                         7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1110531115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-410621114IPR009057Homeodomain-like
PROSITE profilePS5129313.75910641115IPR017884SANT domain
SMARTSM007172.1E-710651113IPR001005SANT/Myb domain
PfamPF002491.5E-610671109IPR001005SANT/Myb domain
CDDcd001678.40E-610681110No hitNo description
PROSITE profilePS5129317.47912961347IPR017884SANT domain
SMARTSM007177.5E-1012971345IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-1112981348IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-712991344IPR009057Homeodomain-like
PfamPF002495.6E-813001341IPR001005SANT/Myb domain
CDDcd001672.45E-713011339No hitNo description
SuperFamilySSF466897.33E-1116251680IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-716281679IPR009057Homeodomain-like
PROSITE profilePS5129310.81116311682IPR017884SANT domain
SMARTSM007171.2E-816321680IPR001005SANT/Myb domain
PfamPF002495.8E-816351676IPR001005SANT/Myb domain
CDDcd001676.52E-616351678No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 2317 aa     Download sequence    Send to blast
MDKEVKEVSQ PQVFPVREGK MEAGLHCMSP LAQRALCHEP SCDRMQLPAT IHSVMAEATN  60
DTGERISRVR SGPFSSSVQP KSANLIRTAP PIGKKVIRGR LEAWRGRFDN VWDDHDSGNS  120
SWHGPTRDNR KSDETRRERE DRELRRNDDR DRKEEREQRR SDERSERDEP RRVRSATFGS  180
ERVFSSIRGL TAMDDRERDR DRDYRQGGRS GDDSGRMIQR ERSFNGAISS ISDRSSVTQF  240
GSGKDWSVGD KRSDLSRFER YGTGNRDGSR AEYEGHGRDS SFTNGWRRER SHSGVTARHS  300
SFAFGNKNFG EHGSRGSLLL SSGHDSHYAT TLSSNHDSDH PSPSKRPRLG WGQGLAKYEK  360
KVGDTDDVSP PVEKHDTKKD AESEAHRHVE EFEENRDMLD EKRSEIVPSG GSLDASLDLH  420
KKRPMPGVHY ENKQEDKEGI TDCLEKQEKS ENKSILWRDG GGRERSGQDK NSCALYGDGM  480
GIKGEDEKKA ALSEELLGLE QSPAPPLLLE DCANSTREEM SDSKPALPND TKVSEPNAQD  540
PVSHVLVKGS QNRTEHDDVT LPVLQEHESL EGKDQSLVSS VVVGENEVRG GDLMKSSSLV  600
EMREEVIEDR PKNVISLTES LQCSVDAKMV CLSSSQSSPT SVSTRFEKSP IHSERDAITI  660
PALCERKETE EGLFLSRESS MTSVPEGFVV ELMSEGTPPV SMDLDEDKNV KDVLELVPVE  720
AISDSTDEVK DVKLVMELVP VEALPESIGE DKDVRSLPHE LMSAGVPSIV EKAKDVRGVA  780
PETVSANVPP EPMILDTDKG IGGMSLELMQ SGVPLESMIV DNDEVIGGEL SGSMAQSLGS  840
EEPDYYKNQF GSEVVPRRSL RLECDLSMID SFLMENKEKA RLAGASFVHL LPLSLTGDIQ  900
QQLYHSPTEA PVWQRNIETH KNIQDRLLRK LAERHHFCKF KERVLTLRFR ALKEAWKREQ  960
KGLFERKNRP KAVDRRDIER RSNHGPPSQR SSLRLRPFSL SRLDVESEAA EAMKKLMKDP  1020
HVEAFCPVLK MPAMILDEKE RASRRFVSRN ALVEDPVAVE MERKILNPWT TEEKKIFAEK  1080
FALHRKSFKE IASNLKYKTT ADCIEYYYRN HKSEDFDKSK KGVHSKDRGD HTKTSSTFLT  1140
PTSAGIKRNH EANCARLEAI NVVNMNTKLS QINSPVLEHA KPTTLSNGPL PVPAGADIPR  1200
LNLKESEVPE VVLPSGATAE IATVETATSS LMSTPCSVSS TPAPVTDQWN GRSSVKERVG  1260
RGLSTTRCFL SERHPAGPKG TRSTHLRRLS SRAAAQEDSQ WTDEERELFT SAVATYGKDF  1320
RLIASHVGSK NLSQCKAFFS KTRKRLGLDE LVEQFEANEA AAMLMQSFRH EADLVQEAKL  1380
ISSAEDMQMD SSAGVLAHSV EELSDTAAAV STLESLKVQS KCLTNDMSDL SLVADAAAVM  1440
EEITLEKSEC TAQDLFSNEK SLTQSEELAH ELLKVDPSNC TVLPARIRQE EENDSEATKS  1500
DDSYQVGAET ESDIVVDQAA AALLGMSEMS ADAPGLKKSK SEAKICTKSS PVSVFSRSQS  1560
ARLPTSSPPS HSVMEVNLSL TSERNSRQLK ERVNPTVSCK PTTRERPQDM LDAHTGRKSR  1620
EVVGGEPKPR REPTSWTQEE KEKFAVILQE HGKDWALLHE SLPSKSLTQI KTYFQNSKAR  1680
SRLPASDKLL NVARSDVGNR KRKADEFDST RKAAELALPL KQKVRGNVAP PEFDNSNHKE  1740
DSLLGSSSVS GTAGVGVDIL PYAARFGSFP SQPVGQDTLN INGMHSVRQM PTSNYSQGTT  1800
QDGHQVFRPG ERPSLPNPVA TRSHHGDVVL QQFSDPGLSM TGDPDLQGLS QGVVPQAGPP  1860
AAIHQVAQQV QQMLAQQQHL QKQLALLLQQ QAALPQALLP QHQQATQQTL QAVRPLEKKL  1920
HQVVQQLQHQ QALAQNQEMG IHNHMHFQQQ QLPQGRGILK VKPIRGAISK PLSDLAGSPS  1980
QGVFQNQCNS RNQDIQLHQQ GHSLLLGIGT NPAVTAGSTA GLLKNHAKTL DVQDSDTDSD  2040
CEGMGSMQMV ADDSHQRMSV VHSTSSGQQQ GAAQSTTSTL SSDSEQVKSW DVKLFGQSLL  2100
SKPPSLPSSV PRTAGSSMQE FVKPSTSSPA TSVTFPTGTL SKGFRSSESL PSAFGRVGAS  2160
SSVADGQLVP WAGMTNLSGK LSQYGAWSTT NSLQVSGVTE AAGKEPDSVS TQEAATSVAS  2220
QSDRQHTDAQ VLVSAPEQGL QGNDEHRDSE SGLSAGQSET PVCGTAVAES PFLDGSQNRS  2280
IEHVSSPDAD QCRIGLEPTS HINSLPTISA GPGQWG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-1510311116993NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-1510311116993NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001763498.10.0predicted protein
TrEMBLA9SAP60.0A9SAP6_PHYPA; Predicted protein
STRINGPP1S61_39V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-41MYB family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]